Size

50 μg

Catalog no#

RPC20020

Price

313 EUR

Gene number

Cd74

Protein origin

E.coli

Use before

1 year

Protein number

P04441

Protein purity

≥ 90%

Expected molecular weight

29.5kDa

Protein region

56-279aa

Shipping requirements

Blue ice

Group

recombinants

Latin name

Mus musculus

Estimated production time

7-11 business days

Information about sequence

Extracellular Domain

Verified reactivity

Mus musculus (Mouse)

Source

Recombinants or rec. proteins

Notes

For research use only. Not for diagnostic procedures.

Storage recommendation

Aliquot and store at -20°C. Minimize freezing and thawing.

Description

Antigens are peptides or recombinant or native dependent on the production method.

Other name

Ia antigen-associated invariant chain ; IiMHC class II-associated invariant chain; CD74

Protein sequence

QQQGRLDKLTITSQNLQLESLRMKLPKSAKPVSQMRMATPLLMRPMSMDNMLLGPVKNVTKYGNMTQDHVMHLLTRSGPLEYPQLKGTFPENLKHLKNSMDGVNWKIFESWMKQWLLFEMSKNSLEEKKPTEAPPKVLTKCQEEVSHIPAVYPGAFRPKCDENGNYLPLQCHGSTGYCWCVFPNGTEVPHTKSRGRHNCSEPLDMEDLSSGLGVTRQELGQVTL

Test

Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.