Size

10 μg

Catalog no#

RPC20212

Price

165 EUR

Gene name

Tp53

Protein origin

E.coli

Use before

1 year

Protein number

P10361

Protein region

1-391aa

Protein purity

≥ 90%

Expected molecular weight

47,5kDa

Shipping requirements

Blue ice

Information about sequence

Full Length

Group

recombinants

Tissue

cellular, tumor

Latin name

Rattus norvegicus

Estimated production time

7-11 business days

Other name

Tumor suppressor p53

Verified reactivity

Rattus norvegicus (Rat)

Source

Recombinants or rec. proteins

Verified applications

See product datasheet or contact us

Notes

For research use only. Not for diagnostic procedures.

Storage recommendation

Aliquot and store at -20°C. Minimize freezing and thawing.

Description

Antigens are peptides or recombinant or native dependent on the production method.

About

Rats are used to make rat monoclonal anti mouse antibodies. There are less rat- than mouse clones however. Rats genes from rodents of the genus Rattus norvegicus are often studied in vivo as a model of human genes in Sprague-Dawley or Wistar rats.

Protein sequence

MEDSQSDMSIELPLSQETFSCLWKLLPPDDILPTTATGSPNSMEDLFLPQDVAELLEGPEEALQVSAPAAQEPGTEAPAPVAPASATPWPLSSSVPSQKTYQGNYGFHLGFLQSGTAKSVMCTYSISLNKLFCQLAKTCPVQLWVTSTPPPGTRVRAMAIYKKSQHMTEVVRRCPHHERCSDGDGLAPPQHLIRVEGNPYAEYLDDRQTFRHSVVVPYEPPEVGSDYTTIHYKYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENFRKKEEHCPELPPGSAKRALPTSTSSSPQQKKKPLDGEYFTLKIRGRERFEMFRELNEALELKDARAAEESGDSRAHSSYPKTKKGQSTSRHKKPMIKKVGPDSD