Size

10 μg

Catalog no#

RPC20241

Price

165 EUR

Gene name

Psca

Protein origin

Yeast

Use before

1 year

Protein number

P57096

Protein region

21-95aa

Expected molecular weight

10,4kDa

Protein purity

≥ 90%

Shipping requirements

Blue ice

Information about sequence

Full Length

Group

recombinants

Latin name

Mus musculus

Estimated production time

7-11 business days

Other name

no alternative name

Verified reactivity

Mus musculus (Mouse)

Tissue

cell, prostate, stem

Source

Recombinants or rec. proteins

Verified applications

See product datasheet or contact us

Notes

For research use only. Not for diagnostic procedures.

Storage recommendation

Aliquot and store at -20°C. Minimize freezing and thawing.

Protein sequence

LQCYSCTAQMNNRDCLNVQNCSLDQHSCFTSRIRAIGLVTVISKGCSSQCEDDSENYYLGKKNITCCYSDLCNVN

Description

Antigens are peptides or recombinant or native dependent on the production method.For cells, cell lines and tissues in culture till half confluency.

Test

Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.Stem cell factors and stem cell growth factors will produce stem cells or be part of a transdifferentiation process to produce other cells. A cell can transdifferentiate by going back to the naive stem cell stadium or directly into the other cell, helped by the stem cell and transdifferentiationf actors. Stem cell growth factors or stem cell factors are mostly used to produce iPSCs or induced pluripotent stem cells by Jamaka or Thomson factors by using for example 5 Lenti-III-CMV viruses, expressing the Yamanaka iPSC factor set (Oct4, Sox2, Nanog and Lin28) + GFP positive control. Trans differentiation will omit the stem cell stadium but stem cell factors sill play an important role in trans differentiation strategies.