Size

10 μg

Catalog no#

RPC20468

Price

165 EUR

Protein origin

E.coli

Use before

1 year

Protein number

P04229

Protein purity

≥ 90%

Gene name

HLA-DRB1

Protein region

30-227aa

Shipping requirements

Blue ice

Expected molecular weight

41,97kDa

Group

recombinants

Estimated production time

7-11 business days

Information about sequence

Extracellular Domain

Verified reactivity

Homo sapiens (Human)

Other name

MHC class II antigen DRB1*1

Source

Recombinants or rec. proteins

Verified applications

See product datasheet or contact us

Notes

For research use only. Not for diagnostic procedures.

Storage recommendation

Aliquot and store at -20°C. Minimize freezing and thawing.

Description

Antigens are peptides or recombinant or native dependent on the production method.

Protein sequence

GDTRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSK

Properties

Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.