Size

10 μg

Catalog no#

RPC20177

Price

165 EUR

Gene name

HLA-G

Protein origin

E.coli

Use before

1 year

Protein number

P17693

Information about sequence

partial

Expected molecular weight

62,9kDa

Protein purity

≥ 90%

Protein region

25-338aa

Shipping requirements

Blue ice

Group

recombinants

Estimated production time

7-11 business days

Verified reactivity

Homo sapiens (Human)

Source

Recombinants or rec. proteins

Verified applications

See product datasheet or contact us

Other name

HLA G antigen; MHC class I antigen G

Notes

For research use only. Not for diagnostic procedures.

Storage recommendation

Aliquot and store at -20°C. Minimize freezing and thawing.

Description

The Recombinant HLA class I histocompatibility antigen, alpha chain G protein(HLAG),partial is a α- or alpha protein sometimes glycoprotein present in blood.Antigens are peptides or recombinant or native dependent on the production method.

Protein sequence

GSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD

Properties

Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.