Size

10 μg

Catalog no#

RPC20387

Price

165 EUR

Tissue

cell

Protein origin

E.coli

Use before

1 year

Protein number

Q14002

Gene name

CEACAM7

Protein purity

≥ 90%

Protein region

36-242aa

Shipping requirements

Blue ice

Expected molecular weight

39,34kDa

Information about sequence

Full Length

Group

recombinants

Estimated production time

7-11 business days

Verified reactivity

Homo sapiens (Human)

Other name

Carcinoembryonic antigen CGM2

Source

Recombinants or rec. proteins

Verified applications

See product datasheet or contact us

Notes

For research use only. Not for diagnostic procedures.

Storage recommendation

Aliquot and store at -20°C. Minimize freezing and thawing.

Protein sequence

TNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLIQNVTHNDAGFYTLHVIKENLVNEEVTRQFYVFSEPPKPSITSNNFNPVENKDIVVLTCQPETQNTTYLWWVNNQSLLVSPRLLLSTDNRTLVLLSATKNDIGPYECEIQNPVGASRSDPVTLNVRYESVQAS

Properties

Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.

Description

cell adhesion molecules play a role in cell growth and activation and are often identified by WB or ELISA as in the Recombinant Carcinoembryonic antigen- adhesion molecule 7(CEACAM7).Antigens are peptides or recombinant or native dependent on the production method.For cells, cell lines and tissues in culture till half confluency.Whole adhesion and interacting molecules are present in lysates used as reference for ELISA quantification of these molecules and their subunits.