Size

10 μg

Catalog no#

RPC20225

Price

165 EUR

Protein origin

Yeast

Expected molecular weight

20kDa

Gene name

CTAG1A

Disease

cancer

Tissue

testis

Use before

1 year

Protein number

P78358

Protein region

1-180aa

Protein purity

≥ 90%

Shipping requirements

Blue ice

Information about sequence

Full Length

Group

recombinants

Estimated production time

7-11 business days

Verified reactivity

Homo sapiens (Human)

Source

Recombinants or rec. proteins

Verified applications

See product datasheet or contact us

Notes

For research use only. Not for diagnostic procedures.

Storage recommendation

Aliquot and store at -20°C. Minimize freezing and thawing.

Description

Antigens are peptides or recombinant or native dependent on the production method.

Other name

Autoimmunogenic cancer/testis antigen NY-ESO-1Cancer/testis antigen 6.1 ; CT6.1L antigen family member 2 ; LAGE-2

Protein sequence

MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAASGLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAADHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR

Properties

Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.