Size

100 μg

Catalog no#

RPC20584

Price

1256 EUR

Gene number

HLA-G

Protein number

P17693

Use before

1 year

Protein purity

≥ 90%

Protein region

25-338aa

Expected molecular weight

18.18kDa

Shipping requirements

Blue ice

Information about sequence

Full Length

Group

recombinants

Protein origin

Mammalian cell

Estimated production time

7-11 business days

Verified reactivity

Homo sapiens (Human)

Source

Recombinants or rec. proteins

Other name

HLA G antigen; MHC class I antigen G

Notes

For research use only. Not for diagnostic procedures.

Storage recommendation

Aliquot and store at -20°C. Minimize freezing and thawing.

Description

The Recombinant HLA class I histocompatibility antigen, alpha chain G protein(HLA-G) is a α- or alpha protein sometimes glycoprotein present in blood.Antigens are peptides or recombinant or native dependent on the production method.

Protein sequence

GSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD

Properties

Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.