Size
10 ug
Catalog no#
CG18-10
Price
203 EUR
Species reactivity
Human
UniProt number
Q08722
Estimated molecular weight
40,8 kDa
Origin
Human cells
Group
recombinants
Shipping condition
Ambient/Room Temperature
Source
Recombinants or rec. proteins
Protein purity
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin level
Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Package form
Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Additional description
Antigens are peptides or recombinant or native dependent on the production method.
Description
Recombinant Human CD47 is produced by our Mammalian expression system and the target gene encoding Gln19-Pro139 is expressed with a Fc tag at the C-terminus.
Storage conditions
Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
Reconstitution conditions
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Peptide sequence
QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Properties
Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.